PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2AL_FA1957F59.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 247aa    MW: 27209.6 Da    PI: 10.5847
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2AL_FA1957F59.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.64.2e-1142100563
                            CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                            kr++r + NR +A rs +RK  +i+eLe+kv+ L++e ++L  +l+ l+   + l++e+
  Traes_2AL_FA1957F59.1  42 KRAKRIMANRQSAARSKERKMRYIAELERKVQCLQTEATTLSAQLSLLQRDTSGLTNEN 100
                            9***********************************************99988888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.9E-1738102IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.72640103IPR004827Basic-leucine zipper domain
PfamPF001701.1E-94299IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.01E-114293No hitNo description
Gene3DG3DSA:1.20.5.1701.2E-114297No hitNo description
CDDcd147038.81E-214392No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MSMDGSTSFG SASSGVSGRH GADAKKAISD AKLAELALVD PKRAKRIMAN RQSAARSKER  60
KMRYIAELER KVQCLQTEAT TLSAQLSLLQ RDTSGLTNEN GDLKLQVQTM EQQVRLQDAL  120
NDRLRDEVQQ LKIATGQLNA NNGSLGNFGG LSSYGVNPQS YQRSQMQQQS LLAAQHLQQL  180
QIHSQHQQPQ MHLQQQRLGS VRQQQQSQLR PEALPFPGDL KMKGIAMTAH VQNAGPSPFD  240
GRARSEP
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3668880.0AK366888.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2047M20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976085.11e-101PREDICTED: transcription factor RF2a-like
SwissprotQ040884e-64POF21_ARATH; Probable transcription factor PosF21
TrEMBLW5AYW31e-179W5AYW3_WHEAT; Uncharacterized protein
STRINGMLOC_64362.11e-104(Hordeum vulgare)
STRINGGRMZM2G112483_P011e-103(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123022937
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.18e-59bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]